Vasoactive Intestinal Peptide (VIP): Investigating the Pillars of Neuroendocrine Signaling and Immunomodulatory Pathways

Vasoactive Intestinal Peptide (VIP) is a specialized 28-amino-acid neuropeptide engineered for advanced experimental investigation within neuroendocrine regulation, vasodilation, and mucosal immune homeostasis. Classified among premier neuropeptidergic signaling modulators, it commands significant interest in contemporary laboratories due to its distinct G-protein coupled receptor binding specificity and robust interaction characteristics. Researchers source Vasoactive Intestinal Peptide (VIP) to evaluate complex cyclic AMP signaling cascades, neuroprotection models, and cellular regulatory networks, making it a critical asset for comprehensive in vitro trials.

What is Vasoactive Intestinal Peptide (VIP)?

Vasoactive Intestinal Peptide (VIP) is a meticulously synthesized neuropeptide belonging to the glucagon/secretin superfamily, consisting of a 28-amino-acid chain (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2). Structurally, it is designed to interact selectively with specific class B GPCRs while offering high stability and targeted activity across neural, gastrointestinal, and immune cell models.

• Chemical Composition: Synthetic 28-amino-acid neuropeptide belonging to the glucagon/secretin family.

• Primary Biological Targets: VPAC1 and VPAC2 G-protein coupled receptors located throughout neural, epithelial, and immune tissues.

• Form: Lyophilized powder engineered for optimal reconstitution accuracy.

The Critical Importance of Vasoactive Intestinal Peptide (VIP) in Modern Research

In modern experimental frameworks, maintaining compound integrity across extended testing cycles is paramount. Vasoactive Intestinal Peptide (VIP) provides exceptional structural stability and precise receptor engagement, minimizing rapid enzymatic degradation during cellular assays. Its predictable kinetic profile allows researchers to establish reliable baselines when studying multi-pathway interactions, neuroendocrine adaptation models, and systemic homeostatic dynamics.

How Vasoactive Intestinal Peptide (VIP) Functions in Laboratory Research

• Receptor Activation: Interacts selectively with VPAC1 and VPAC2 membranes to stimulate adenylate cyclase and elevate intracellular cyclic AMP (cAMP) levels in controlled cell cultures.

• Immunomodulation: Influences regulatory pathways associated with pro-inflammatory cytokine suppression and lymphocyte activity modulation during assays.

• Signaling Crosstalk: Modulates receptor-mediated communication between neuroendocrine and immune tissue models under experimental stress frameworks.

• Cellular Adaptation: Regulates gene expression markers linked to vasodilation, epithelial barrier preservation, and cellular survival during in vitro assays.

Primary Research Benefits & Applications

• Investigating advanced neuropeptide signaling and neuroendocrine regulation models.

• Assessing VPAC receptor binding affinities and second-messenger activation kinetics in comparative assay models.

• Exploring mucosal immunology and anti-inflammatory mechanisms using specialized in vitro settings.

• Evaluating synergistic applications alongside related research compounds, such as CJC-1295 No DAC + Ipamorelin and standard reference materials available through Peptide Sciences Supplies.

Rigorous Quality Assurance

Every batch of Vasoactive Intestinal Peptide (VIP) undergoes strict analytical validation to ensure absolute experimental reliability. Our quality control protocols feature high-performance liquid chromatography verifying >99% purity, alongside mass spectrometry confirmation of molecular weight. Each vial is supplied as a stable lyophilized powder, ensuring maximal shelf-life and structural preservation prior to laboratory reconstitution.

Why Choose Penguin Peptides

Penguin Peptides delivers uncompromised quality for laboratory and academic researchers worldwide. Benefit from our exclusive promotional code PP10 to receive 10% off your order, or take advantage of our automatic 20% discount on all cryptocurrency transactions. We provide secure SSL encryption across our platform alongside fast, reliable shipping to ensure your research materials arrive securely and on schedule.

Frequently Asked Questions (FAQs)

How should Vasoactive Intestinal Peptide (VIP) be reconstituted for laboratory assays?

Reconstitution should be performed using bacteriostatic water or sterile PBS depending on your specific experimental protocol. Gently introduce the solvent down the side of the vial without vigorous shaking to maintain peptide integrity.

What are the optimal storage conditions for Vasoactive Intestinal Peptide (VIP)?

Prior to reconstitution, store the lyophilized powder at -20°C. Following reconstitution, store the solution between 2°C and 8°C and utilize within the recommended experimental window.

Is this product approved for human use?

No. All products distributed by Penguin Peptides are strictly intended for laboratory research purposes.

Conclusion

Vasoactive Intestinal Peptide (VIP) stands as an exceptional compound for investigators dedicated to uncovering the intricacies of neuroendocrine signaling, VPAC receptor kinetics, and immunomodulation. With verified high purity, rigorous analytical testing, and reliable batch consistency, it provides the precise foundation necessary for advanced molecular research.

Disclaimer: This product is sold strictly for in vitro and laboratory research use only. It is not approved for human consumption, therapeutic use, clinical diagnosis, or administration to humans or animals.